Background
Influenza A virus, one of the most important pathogen, causes perennial epidemics and occasional pandemics with a huge impact on global health and economy. As a zoonotic agent it has potential to cause diseases not only to the poultry industry, but also to the humans and many species of mammals[
1]. Among the two strategies; prevention and therapeutic, prevention being the preferred option to combat the influenza infection[
2]. Thus, several kinds of influenza vaccines are developed, such as inactivated whole virus vaccines, split vaccines, subunit vaccines, and virus-like particles[
3‐
6]. Among them, inactivated influenza virus vaccines are the most commonly use to prevent influenza-associated illness[
7]. Current inactivated vaccines are formulated as a trivalent blend based on known protective surface antigen hemagglutinin (HA) and neuraminidase (NA) and are designed by predicting the forth coming virus strains, which requires reformulation regularly. However, production of an egg-based trivalent vaccine is time consuming and limits the chance to change the antigen in an emergency situation[
8]. Moreover, current strategies using inactivated whole virus vaccines face an annual problem of HA and NA antigenic mismatch with circulating influenza viruses due to repeated antigenic drifting[
9]. Therefore, vaccination strategies for broad protectivity against unpredictable influenza viruses need to be developed.
Several approaches are being investigated to develop broadly protective vaccines and focus mainly on the conserved region of the viral matrix protein-2 (M2) and HA proteins of influenza A virus[
10]. Compared with HA, M2 is highly conserved among and within different subtypes (Table
1), and is therefore an attractive target for developing a broadly protective vaccine. In particular, the extracellular domain of M2 is considered an appropriate target for a broad spectrum influenza vaccine[
11]. The efficacies of different forms of M2-based vaccines have been studied and found that mice immunization with M2 can protect against influenza virus lethal infection[
12‐
14]. However, the protection level was not so significant due to small size and poor immunogenicity of the M2e peptide. Therefore, focus has shifted to the M2 fusion construct using a variety of carrier molecules like M2 peptide-carrier conjugates, baculovirus-expressed M2, M2 fusion proteins, multiple antigenic peptides, and M2 DNA vaccine[
14‐
18]. It has been reported that multimeric form of the M2 fusion protein, such as TLR5 ligand flagellin fused to four tandem copies of M2 induced antibody can protects a lethal challenge of influenza virus in BALB/c mice[
13]. Subsequently, these studies have shown that immunization with M2 or a multimeric form of M2 based vaccine with or without a carrier can protect homologous or heterosubtypic influenza virus infections. However, the longevity and breadth of cross protectivities of M2 are not well studied.
Table 1
Comparison of sM2 sequence among vaccine and challenge strains
Consensus | | MSLLTEVETPTRNGWECKCSDSSEPDRLFFKCIYRRLKYGLKRGPSTEGV | |
A/EM/Korea/W149/06 | H5N1 | MSLLTEVETPTRNE WECR CSDSSD PDRLFFKCIYRRLKYGLKRGPSTEGV | ABW73743.1 |
A/Aquaticbird/Korea/W81/2005 | H5N2 | MSLLTEVETPTRNGWECKCSDSSD PDRLFFKCIYRRLKYGLKRGPSTEGV | EU819138.1 |
A/Puerto Rico/8/34 | H1N1 | MSLLTEVETPIRNE WG CR CNG SSD PDRLFFKCIYRRF KYGLKG GPSTEGV | NC_002016.1 |
A/Aquaticbird/Korea/W44/2005 | H7N3 | MSLLTEVETPTRNGWECR CSDSSD PDRLFFKCIYRRLKYGLKRGPSTEGV | JN244137.1 |
A/Chicken/Korea/116/2004 | H9N2 | MSLLTEVETPTRNGWECKCSDSSD PL RLFFKCIYRRLKYGLKRGPSTEGM | EU819104.1 |
Therefore, in this study, a construct named 4sM2 using four tandem copies of consensus sM2 gene derived from the analysis of sequences of H1N1, H5N1 and H9N2 influenza viruses without its trans-membrane domain for the induction of broad protection against divergent influenza virus subtypes were developed. The construct was expressed in E. coli and potency of the produced immunogen was evaluated in mouse model against lethal doses of mouse adapted influenza A viruses. In addition, the longevity of the immune responses and breadth of cross protection were examined.
Discussion
M2 is one of the most promising conserved antigens, produced by translation from a spliced mRNA derived from influenza gene segment 7, which also cedes for matrix protein M1. It is a type III transmembrane protein in the form of a tetramer that functions as a pH-regulated proton channel and sparsely present on virus particles but is abundant on the surface of virus-infected cells[
19]. Various M2e sequences of M2 constructs have been expressed and used as vaccines. In previous study, it has shown that H5 derived vaccines may also protect circulating H1N1 and H3N2 subtypes. Nevertheless, M2 vaccines might also protect against an unexpected subtypes that could cause a pandemic though protection across substantial divergence[
16].
Thus, we developed sM2 consensus derived from the analysis of sequences of H5N1, H1N1 and H9N2 subtypes in the database. Considering the previous findings that extracellular domain particularly (aa, 1–13) is highly conserved among the influenza virus subtypes and recognized as epitope for the induction of monoclonal antibodies and protection against influenza virus infection[
20‐
22], sM2 backbone sequence from the H5N1 virus were used. For the possible homology among other subtypes we changed at the position of 14 (E-G), 18 (R-K) and 24 (E-D) and kept unchanged the conserved epitope (aa, 1–13). As shown in sequence alignment, sM2 of consensus sequence has 1–8 mismatches among the subtypes used in this study (Table
1). The developed sM2 plasmids (monomeric and multimeric) were successfully expressed in
E. coli and subsequently purified on Ni-NTA agarose. The purified proteins were formulated in PBS buffer and tested for its ability to stimulate the immune response and the level of protection against lethal challenge of divergent influenza subtypes.
The M2 specific antibody cannot contribute directly to neutralize virus
in vitro, the antiviral effect of an M2-based vaccine may be exhibited by antibodies to the M2 antigen through antibody-dependent cell-mediated cytotoxicity[
11]. Therefore, induction of the M2 specific antibody level was investigated after two intramuscular doses. High level of M2 specific antibody was identified following immunization with Freund’s adjuvant, which is the most commonly used adjuvant in animal experiment model (Figure
2A and B). Our study also demonstrated that 4sM2 vaccination induces antibodies reacted to purified virions regardless of HA subtypes (Figure
2D).
For investigating the possible mechanism of protection associated with sM2 based vaccine, the isotyping of IgG were performed and found both IgG1 and IgG2a were predominantly induced by 4sM2 vaccinated mice which may contributed to reduction of lung virus titers. Previous study showed that recombinant HA of influenza virus (rHA) with nanoparticles (NP) could induce IgG1 and IgG2a as high as half dose of inactivated virus vaccine (IV) without adjuvant. IgG2a was dominant in case of both rHA and IV when administered with NP adjuvant[
23]. On the contrary, Zhao
et al. demonstrated that M2e peptide with ASP-1 adjuvant could not increase the Th1 (IgG2a) immune response compare to Th2 (IgG1) and suggesting that the selection of an appropriate adjuvant and its unique ability to stimulate functional immune response is critical to the success of M2e based vaccine[
24]. However, induction of M2 specific IgG2a antibodies contributes the clearance of viruses[
18]. Similarly, reduction of virus titers in the lungs of 4sM2-vaccinated mice after a lethal infection of divergent influenza subtypes (Figure
4A, B, C, D and E) indicated the contribution of 4sM2 induced IgG2a for the clearance of virus. In addition, the 4sM2 vaccination also can reduce the severity of lung damage by inhibiting viral replication and accumulation of inflammatory cells in lung alveolar tissues (Figure
4F).
Since the first report of cross protection by Slepushkin
et al.[
25], numerous studies have done with different approaches to provide cross protection immunity using the conserved M2 sequence. A number of Studies already been conducted focusing on the monomeric M2e proteins expressed in
E. coli, M2 DNA vaccine, M2 peptide, M2 protein conjugates with different molecules and M2 VLP[
14‐
17]. The routes of administration and the cross protection also been investigated[
10,
18]. However, for the increasing protection levels, focus goes to multimeric form of M2 protein and peptide. Study showed that 4 × M2e conjugated Mycobacterium tuberculosis HSP70 (mHSP70) fusion protein provided full protection against lethal dose of mouse-adapted H1N1, H3N2, or H9N2 influenza A isolates[
26]. A Similar study by Alvarez
et al.[
27] demonstrated that four copies of the M2e peptide to the BLS molecule (
Brucella abortus derived antigen) were capable to induce 100% protection from viral challenge in BALB/c mice. Recently, Kim
et al.[
28] reported on cross-protection regardless of influenza virus subtypes by tandem repeat of M2e (M2e5×) expressing virus like particles. The multimeric M2e-based vaccines reported have shown to be effective for cross protection when conjugated to other molecules or delivered as a whole virus and mainly based on conserved epitope of M2 ectodomain (M2e) which is small in size and low immunogenic. However, in the present study, we used sM2 constituted both ecto and cytoplasmic domain without the transmembrane domain for the enhancement immunogenicity and breadth of protection, which is utmost important to protect unexpected outbreak of influenza infection.
The cellular immune response plays an important role in vaccination. Previous studies have reported on antibodies and cell-mediated cytotoxicity specific to the M2 antigen and their anti-viral activity[
29] and
E. coli expressed monomeric M2, three copies of M2 fused with ASP-1 significantly induce anti-M2 Th1 and Th2 associated antibodies[
24]. Wu
et al.[
30] reported that nucleotide based CpG-ODN adjuvant with M2 peptide significantly increased M2-specific IgG2a and IFN-γ secreting lymphocytes. In agreement with those findings, we examined the Th1-type (IFN-γ) and Th2-type (IL-4) cytokine responses by ELISPOT assay. Heightened levels of IFN-γ were detected in response to stimulation of both the sM2 protein and M2 peptide in mice immunized with the 4sM2 protein but not in non-immunized mice (Figure
2E). Similarly, we observed substantially high levels of IL-4 in immunized mice upon stimulation with the sM2 protein and M2 peptide (Figure
2F). Together, these results indicate that four tandem copies of sM2 with Freud’s adjuvant induced a cellular immune response that may contributed to protecting mice from widely divergent influenza subtypes from both phylogenetic group 1 (H1, H5, H9) and group 2 (H7)[
31].
Our study revealed that reconstituted 4sM2 protein which from
E. coli induced long lasting immunity and conferred protection against a heterosubtype influenza virus lethal infection even at 6 months after final vaccination (Figure
5B and C). Our findings supported by the previous observation that M2 VLP confers long-term immunity and cross protection[
18]. Also, a report by Price
et al. showed long lived NP/M2 specific IgG and IgA antibodies in sera and mucosal sites[
32]. In agreement with these findings, we found that the sM2 specific antibody-mediated immunity was long lived (Figure
5A), which is important for any successful vaccine.
Conclusion
Influenza A viruses are responsible for three major pandemics in the twentieth century and occasionally outbreaks in various hosts such as, humans, avian species, and some types of mammals. It has one of the highest infection rates of all human viruses which can infect people of all ages[
33]. Efforts to develop effective influenza vaccines are repeatedly challenged due to the genetic instability of HA and NA[
34]. A vaccine consisting of a genetically conserved influenza antigen would provide a second layer of protection against multiple strains and could offer the promise of influenza vaccination in the developing world where the current seasonal strategy is not practical[
35]. Therefore, the development of universal influenza vaccines against various subtypes is badly needed and should be studied continuously. In this study, the efficacy of reconstituted multimeric sM2 proteins (4sM2) which expressed in
E. coli in providing cross-protection against lethal infection of divergent influenza subtypes were demonstrated. We showed evidence that vaccine containing multimeric sM2 which in this case 4sM2 proteins could be potential candidate for inducing cross-protection, as shown against A/EM/Korea/W149/06(H5N1), A/PR/8/34(H1N1), A/Aquatic bird/Korea/W81/2005(H5N2), A/Aquatic bird/Korea/W44/2005(H7N3), and A/Chicken/Korea/116/2004(H9N2) influenza subtypes. The cross reactivity and protective efficacy suggests that 4sM2 protein, could potentially promote protection against influenza subtypes. Overall, our results demonstrate that four tandem copies of consensus sM2 conferred broad protective immune responses against divergent influenza subtypes in a mouse model, suggesting that sM2 could be used to produce a broadly protective influenza vaccine.
Materials and methods
Construction of recombinant plasmid with four copies of the sM2 gene
A gene encoding the consensus sM2 containing residues of extracellular and cytoplasmic domain without the transmembrane domain from the analysis of sequences of H5N1, H1N1 and H9N2 subtypes in the database was chemically synthesized (Figure
1A). Plasmid sM2 and 4sM2 were constructed by cloning as described previously[
36]. The sM2 gene was modified by adding a
Nhe I site at the 5′ terminal and
Bam H I and
Hin d III sites as well as the termination codons TAA and TGA at the 3′ terminal for cloning into the pRSET A vector. The polymerase chain reaction (PCR) was employed to amplify the gene using the primer pair 5′-CTA GCT AGC ATG TCA TTA TTA ACA-3′ (sense 1), 5′-GAA GAT CTA TGT CAT TAT TAA CA- 3′ (sense 2) and 5′-AAG CTT TTA TCA GGA TCC ACC TGA ACC ACC TGA ACC ACC TGA ACC ACC TTC AAG TTC-3′ (anti sense). Two different primer senses were simultaneously used during this multi-cloning process. The sM2 (sense 1) was ligated with pRSET A using a CoreBio 96 plus thermocycler (CoreBio L&B, Seoul, Korea), whereas sM2 (sense 2) was ligated into the T Easy Vector (Invitrogen, Seoul, Korea). Each plasmid was linearized by RE digestion using
Bam H I,
Hin d III for the pRSET A vector and
Bgl II,
Hin d III for the T Easy Vector at 37°C for 2 h and purified by phenol/chloroform/ isoamylalcohol treatment. The linearized plasmids were electrophoresed on a 0.9% agarose gel and recovered using a QIAquick Gel Extraction kit (Qiagen, Hilden, Germany) following the manufacturer’s instructions. The pRSET A vector and sM2 insert (sense 2) were ligated with T4 ligase (TaKaRa Bio, Seoul, Korea) at 16°C for 4 h. Sense 1 for sM2 was fused to sense 2 to produce 2sM2. Consequently, 4sM2 was produced by combining 2sM2 (sense 1) to 2sM2 (sense 2). The ligated products were transformed into
E. coli JM83 competent cells using an electroporation method described previously. The recombinant plasmids were recovered by plasmid DNA extraction following the manufacturer’s instructions using Accuprep Plasmid Mini-prep (Bioneer, Daejeon, Korea). The profiles of the recombinant plasmids were confirmed by restriction endonuclease digestion and DNA sequencing (Solgent, Seoul, Korea).
Expression of 4sM2 proteins in E. coli
Proteins sM2 and 4sM2 were generated using an
E. coli expression system as described previously[
37,
38]. Briefly, recombinant plasmids were introduced into the
E. coli BL21 (DE3) strain using the heat shock method of transformation. A colony was seeded in 5 ml LB broth supplemented with 100 μg/ml ampicillin and 35 μg/ml chloramphenicol and grown at 37°C with shaking. The overnight culture was transferred to 800 ml fresh LB medium and cultured at 37°C with 200 rpm shaking. When the culture reached an optical density (OD) of 600 nm (OD
600) at 0.6, expression of the target proteins were induced by adding 2 mM isopropyl-β-D-thiogalactopyranoside (99% purity; Bio Basic, Ontario, Canada) and incubating for another 12 h at 30°C. Cultures were then harvested by centrifugation at 6,000 × g for 20 min at 4°C. The cell pellets were stored at -20°C overnight.
Isolation, solubilization and refolding of protein from inclusion bodies (IBs)
For the isolation of inclusion bodies (IBs), cell pellets were thawed in ice and re-suspended in 20 ml cold buffer containing 20 mM Tris-HCL, 0.5 M NaCl, 10% glycerol and protease inhibitor (1 mM phenyl methyl sulfonyl fluoride, Sigma-Aldrich, Seoul, Korea). Bacterial lyses was performed by sonication for 3 min with an interval of 2 s pulses and 1 s resting at 25% amplitude and centrifuged (12,000 ×
g, 20 min) at 4°C. Supernatant was removed and remaining pellet retained as IBs. The collected pellet was resuspended with denaturing buffer (20 mM Tris-HCl, 0.5 M NaCl, 10% glycerol and 6 M urea) followed by sonication for 1 min and centrifuged as before. Debris supernatant was discarded; remaining pellet was resuspended with denaturing buffer II (20 mM Tris-HCl, 0.5 M NaCl, 8 M urea, pH 8.0) and kept in 4°C with shaking overnight. The pellet was sonicated and centrifuged as before. Supernatant was separated as rescued protein from IBs, which is ready for purification[
39].
Purification, dialysis and confirmation of 4sM2 specific protein
The target proteins were purified by His-tag affinity chromatography (Qiagen, USA), dialyzed using a permeable cellulose membrane (molecular cut-off: 12–14 kDa, Spectrum Laboratories, East Tamaki, Auckland, USA) for 24 h at 4°C. The dialyzed target proteins were quantified using the Bradford assays (Bio-Rad, Hercules, CA, USA) and confirmed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE). For immune detection of protein, the membranes were probed with mouse anti-histidine antibodies (1:500, Invitrogen, Carlsbad, CA, USA) and rabbit anti-M2 antibodies (1:1000). Rabbit anti-M2 antibody used in this experiment was generated by i.m. inoculation of KLH conjugated M2 peptide to the rabbit, two times of 2 weeks interval. Membranes were reacted with a 1:1000 dilution of anti-mouse or anti-rabbit IgG HRP. Finally, the target proteins were detected using the WEST-ZOL plus Western Blot Detection System (iNtRON Biotechnology, Gyeonggi-do, South Korea) and visualized by enhanced chemiluminescence (ECL). The purified proteins were used as a vaccine[
23].
Animals, viruses, and vaccination
Preliminary experiment was conducted to determine the doses and efficacy of sM2 and 4sM2 protein on influenza virus infection. Mice vaccinated with sM2 (10 μg and 30 μg) showed 40% and 60% survival respectively while the mice vaccinated with 4sM2 (10 μg) registered 60% survival and the 4sM2 (30 μg) showed 100% survival against lethal infection of H5N1 (data not shown). In this study, monomeric sM2 protein was used as coating antigen for ELISA and stimulator in ELISPOT, multimeric 4sM2 protein used for vaccine study. For this, a total of 138 female BALB/c mice (5 weeks old) were purchased from Samtako (Seoul, Korea) and acclimated for 7 days at room temperature prior to use. Mice were divided into six experimental sets (Table
2). Four sets contained two groups of 11 mice each. One set had two groups of 17 (6 mice for lung histopathology at 3 and 5 dpi) mice each. The remaining sets had two groups containing eight mice each (for the long lasting and CTL response experiment). Mice were vaccinated i.m. with 30 μg of 4sM2 protein or 0.85% saline at 2 weeks interval as illustrated in Figure
1D. Mice inoculated with 0.85% saline considered as a negative control (NC). The first injection included Freund’s complete adjuvant, and 2 weeks later mice were given a boost with 4sM2 or 0.85% saline in Freund’s incomplete adjuvant.
Table 2
The design groups for mouse experiment
4 | 0.85% saline | Freund’s | i.m. | 11 | 3 for each time | 5 | - | - | H5N1 H1N1 H7N3 H9N2 |
4sM2 | Freund’s | 11 | 3 for each time | 5 | - | - |
1 | 0.85% saline | Freund’s | 17 | 3 for each time | 5 | 3 + 3 | - | H5N2 |
4sM2 | Freund’s | 17 | 3 for each time | 5 | 3 + 3 | - |
1 | 0.85% saline | Freund’s | 8 | - | 5 (long lasting) | - | 3 | H5N2 |
| 4sM2 | Freund’s | | 8 | - | 5 (long lasting) | - | 3 | |
The highly pathogenic (HPAI) A/EM/Korea/W149/06(H5N1), A/Puerto Rico/8/34(H1N1), A/Aquatic bird /Korea/W81/2005(H5N2), A/Aquatic bird/Korea/W44/2005(H7N3) and A/Chicken/Korea/116/2004(H9N2) influenza subtypes used in this study, were obtained from the virus collection at the College of Medicine and Medical Research Institute, Chungbuk National University, Cheongju, Republic of Korea. All viruses were propagated in allantoic fluid from 10-day-old chicken embryos.
Sample collection
Blood were collected to analyze serum antibody levels at 0, 7, 21, and 180 days after vaccination. Blood were collected from the retro-orbital plexus, incubated at room temperature for 30 min; sera were separated by centrifugation (12,000 × g, 5 min) and stored at -20°C until analysis. Ether narcosis-anesthetized mice were bled from the heart with a syringe, dissected to expose the thoracic cavity, and the lungs were collected aseptically to determine lung virus titer and lung histopathology. Samples for the lung virus titer were stored at -70°C, and the histopathology samples were fixed in 10% formalin until analysis[
36,
40].
Evaluation of antibody
The antibody level specific to sM2 was evaluated by ELISA as described previously[
23,
41]. Briefly, 96-well immunosorbent plates (Nunc-Immuno Plate MaxiSorp; Nunc Life Technologies, Basel, Switzerland) were sensitized with 3 μg/ml of sM2 protein, M2 peptide or inactivated purified virions for 12 h at 4°C then washed three times with PBS (pH 7.4) containing 0.05% Tween 20 (PBS-T). The wells were blocked with 300 μl of 10% skim milk in PBS for 2 h at room temperature followed by washing again with PBS-T. Sera were diluted 1: 500 for protein and peptide and 1:100 for virus coated plates, added in triplicate, and incubated for 2 h at 37°C. Following another round of washing rabbit anti-mouse IgG HRP antibody (Sigma, Seoul, Korea) was added to each well (1:1000), and incubated for an additional 2 h at 37°C. Substrate solutions containing tetramethylbenzidine and H
2O
2 were added after final washing. The reaction performed at room temperature and terminated immediately with stop solution (2 N H
2SO
4). Optical density was measured at 450
nm using an ELISA auto reader (Molecular Devices, Sunnyvale, CA, USA).
IgG isotyping was performed under the same conditions described for the IgG ELISA except for the secondary antibody. After the primary antibody reaction, the ELISA plates were incubated with 1000-fold diluted rabbit anti-mouse IgG1 HRP and IgG2a HRP (Zymed, San Francisco, CA, USA) for 2 h at 37°C. Subsequent steps were performed as described for the IgG ELISA.
Enzyme-linked immunosorbant spot (ELISPOT) assay
Cytokine ELISPOTs were developed and counted as described previously to detect and compare the T-cell response to the 4sM2 protein[
42,
43]. Briefly, BD ELISPOT 96-well plates were coated with anti-mouse interferon IFN-γ or interleukin IL-4 capture antibodies in 100 μl PBS/well and incubated at 4°C overnight. The plates were blocked with complete RPMI 1640 medium containing 10% fetal bovine serum (Invitrogen, Carlsbad, CA, USA), and incubated in RT for 2 h. Freshly isolated splenocytes were added at 5 × 10
4 cells/well in media containing the sM2 protein (1 μg/well) or M2 peptide (1 μg/well) or only medium (negative control), or 5 μg/ml phytohemagglutinin (positive control, Invitrogen, Carlsbad, CA, USA). Plates were incubated for 48 h at 37°C in 5% CO
2. After discarding the cells, the plates were treated sequentially with biotinylated anti-mouse IFN-γ and IL-4 antibodies, streptavidin-HRP, and substrate solution. Finally, the plates were washed with deionized water and dried for at least 2 h in the dark. Spots were counted automatically using an Immuno Scan Entry analyzer (Cellular Technology Ltd., Shaker Heights, OH, USA).
Virus challenge
Mice were anesthetized by ether narcosis and infected intranasally with 10MLD50 of challenge viruses in 20 μl PBS. The MLD50 of A/EM/Korea/W149/06(H5N1), A/PuertoRico/8/34(H1N1), A/Aquatic bird /Korea/W81/2005(H5N2), A/Aquatic bird/Korea/W44/2005(H7N3), and A/Chicken/Korea/116/2004(H9N2) viruses were determined in 8 week old naive BALB/c mice. Lungs were collected at 3 and 5 dpi to measure lung virus titers and assess lung histopathology. Remaining mice were monitored for body weight changes and survival. Three mice from one set were selected at random 10 days after the final vaccination to analyze the T-cell immune responses. The remaining mice from the same set were challenged at 180 days (after final vaccination) for the long lasting protection assay.
Virus quantification
Lung virus titers were determined as the 50% tissue culture infectious dose (TCID
50) as described previously[
44,
45]. Briefly, lung tissues were homogenized in 500 μl PBS containing antibiotic and antimycotic compounds (Gibco, Grand Island, NY, USA). The supernatants were collected after centrifugation (12,000 × g, 15 min) of mechanically homogenized lung samples. MDCK cells were inoculated with a 10-fold serial dilution of sample and incubated at 37°C in a humid atmosphere of 5% CO
2 for 1 h. After 1 h of absorption, media was removed and overlay medium containing L-1-tosylamido-2-phenylethyl chloromethyl ketone (TPCK) trypsin (Thermo Fisher Scientific, Rockford, USA) was added to the infected cells and incubated for 3 days. Viral cytopathic effects were observed daily, and titers were determined by the HA test. For HA, chicken red blood cells (0.5%) were added to 50 μl of cell supernatant and incubated for 30 min. The virus titer of each sample was expressed as 50% tissue infected doses using the Reed-Muench method.
Histopathology
Lungs were collected aseptically at 3 and 5 days post infection. Tissues were fixed in 10% formalin solution, embedded in paraffin, sectioned, and stained with eosin. Tissue sections were examined under a light microscope to assess the pathological changes[
46].
Statistics
Data are presented as means ± standard deviations and are representative of at least three independent experiments. Differences between groups were analyzed by analysis of variance (ANOVA) and means were compared by Student’s t-test. P-values less than 0.05 were regarded as significant.
Ethics statement
The research protocols for the use of mice in this study were conducted following approval from the Institutional Animal Care and Use Committee of Bioleaders Corporation (Reference number BLS-ABSL-10-011). Animal experiments were conducted in bio-safety level BSL-2 and BSL-3+ laboratory facilities.
Competing interests
None of the authors have any financial or personal relationships with other people or organizations that could inappropriately influence or bias this study.
Authors’ contributions
CJK and JSL was the principle investigator, wrote the grant application and supervised the study. MYEC and SSK performed the experiments and wrote the manuscript. HJM, MRT, JHK and MEP performed cell culture experiments and data analysis. HYS did histopathology. All authors have read and approved of final manuscript.