A novel anti-MUC1 antibody against the MUC1 cytoplasmic tail domain: use in sensitive identification of poorly differentiated cells in adenocarcinoma of the stomach
Isolated cancer cells of non-solid type poorly differentiated adenocarcinoma (por2) or signet-ring cell carcinoma (sig) are frequently seen in scirrhous gastric cancers with a very poor prognosis. These cells are often scattered in granulation tissue or desmoplastic fibrotic tissue and tend to be overlooked in routine pathological examination. We aimed to raise a novel antibody that can identify the isolated cancer cells easily.
Methods
Because the MUC1 cytoplasmic tail domain (CTD) has many biological roles including tumor progression and cell adhesion disturbance and is expected to be expressed in isolated cancer cells, we raised a novel monoclonal antibody (MAb) MUC1-014E against an intracellular nonrepeating 19-amino-acid sequence (RYVPPSSTDRSPYEKVSAG: N-1217-1235-C) of the MUC1 CTD, using a synthetic peptide including the 7-amino-acid epitope (STDRSPY: N-1223-1229-C).
Results
In the immunohistochemical staining of 107 gastrectomy specimens including 48 por2 and 31 sig lesions, the MAb MUC1-014E showed high rates of positive staining (≥5% of carcinoma cells stained) for por2 (100%) and sig (97%), and of the highest intensity staining (4+, ≥75% of carcinoma cells stained) for por2 (100%) and sig (90%). In the 89 biopsy specimens including 82 por2 and 38 sig lesions, the MAb MUC1-014E showed high rates of positive staining for por2 (100%) and sig (100%) and of 4+ staining for por2 (87%) and sig (84%). All the rates were significantly higher than those with cytokeratins (AE1/AE3 or CAM5.2).
Conclusions
The MAb MUC1-014E is very useful for accurate detection of isolated cancer cells in scirrhous gastric cancers.
Abkürzungen
por2
Non-solid type poorly differentiated adenocarcinoma
sig
Signet-ring cell carcinoma
CTD
Cytoplasmic tail domain
MAb
Monoclonal antibody
JCGC
Japanese Classification of Gastric Carcinoma
H&E
Hematoxylin and eosin
TR
Tandem repeat
MAb MUC1-014E
MAb MUC1-common clone 014E
aa
Amino-acid
KLH
Keyhole-limpet hemocyanin
PAb
Polyclonal antibody
CK
Cytokeratin
PBS
Phosphate-buffered saline
pap
Papillary adenocarcinoma
tub1
Well-differentiated tubular adenocarcinoma
tub2
Moderately differentiated tubular adenocarcinoma
por1
Solid type poorly differentiated adenocarcinoma
muc
Mucinous adenocarcinoma
WHO
World Health Organization
Introduction
Isolated cancer cells of non-solid type poorly differentiated adenocarcinoma (por2) and signet-ring cell carcinoma (sig) of the stomach in the Japanese Classification of Gastric Carcinoma (JCGC) [1] are frequently seen in scirrhous gastric cancers with a very poor prognosis [2]. These cells are often scattered in granulation tissue or desmoplastic fibrotic tissue, which makes likely to be overlooked in a routine histopathological examination using hematoxylin and eosin (H&E) staining. The aim of this study is to raise a novel antibody that can identify the isolated cancer cells easily.
Mucins are high molecular weight glycoproteins with oligosaccharides attached to serine or threonine residues of the mucin core protein backbone by O-glycosidic linkages. These proteins are produced by various epithelial cells. Human mucins are categorized into membrane-associated mucins and secreted mucins [3‐6]. In 1993, we reported the first evidence that pancreatic or biliary invasive carcinomas with aggressive biological behavior usually show expression of MUC1 [7, 8]. Subsequently, we have shown that MUC1 expression is associated with the aggressive behavior of various human neoplasms and with a poor outcome [4]. MUC1 was the first cloned membrane-associated mucin that has been studied in most detail. Full-length human MUC1 synthesized as a single polypeptide is processed into two subunits by proteolytic cleavage: a larger subunit containing most of the extracellular domain including a tandem repeat (TR) domain, and a smaller subunit containing a shorter extracellular domain, a transmembrane domain, and a cytoplasmic tail domain (CTD) (Fig. 1a) [3, 9]. In our previous studies and in most other studies of MUC1 expression in human neoplasms, anti-MUC1 antibodies were raised against the TR region [4, 7, 8].
×
Anzeige
Although the large extracellular domain of MUC1 containing TRs has many functions, recent studies have also suggested that MUC1 CTD has many biological roles including tumor progression and cell adhesion disturbance, although this region contains only 69 amino acids [3, 9‐11]. Thus, we expected that MUC1 CTD plays an important role in isolated cancer cells in scirrhous gastric cancers. In the present study, we raised a novel anti-MUC1 monoclonal antibody (MAb), which we designated as MAb MUC1-common clone 014E (abbreviated as MAb MUC1-014E), against an intracellular nonrepeating 19 amino-acid (aa) sequence (RYVPPSSTDRSPYEKVSAG: N-1217-1235-C) in the CTD (Fig. 1a, b). The 19 aa sequence is common in most human isoforms of MUC1 (thus we named this region MUC1-common), but an antibody against this sequence has not been reported.
In an immunohistochemical study of human gastrectomy and biopsy specimens with gastric cancer, we found that MAb MUC1-014E was able to identify isolated cancer cells in por2 and sig of the stomach. Therefore, MAb MUC1-014E may be of particular value for identifying these cells in resected specimens and biopsy specimens of stomach.
Patients and methods
Selection of the antigen epitope
We aimed to select a specific antigen epitope, to establish a novel anti-MUC1 antibody on the C-terminal side of the cleavage site in MUC1 (Fig. 1a, b), although most of the anti-MUC1 antibodies were raised against the TR region containing Epitope No. 1 on the N-terminal side (Fig. 1a). Four antibodies had already been raised (Fig. 1a) against the aa sequence N-1084-1154-C (Region-1) containing Epitope No. 2 (Fig. 1b) in the short extracellular domain from the cleavage site to the N-terminus of the transmembrane domain (Fig. 1a) [12]. Another commercially available MAb MUC1-Ab-5 (Fig. 1a) binds to the N-1239-1255-C sequence in the C-terminal region of the MUC1 CTD (Region-6) (Fig. 1b) [13]. Thus, we focused on the sequence N-1155-1238-C, which we refer to as the MUC1 universal region (Fig. 1a) because it is highly conserved in isoforms of human MUC1.
In the universal region, three predicted B-cell epitopes, No. 3 (CRRKNYG: N-1186-1192-C), No. 4 (YPTYHTH: N-1209-1215-C), and No. 5 (STDRSPY: N-1223-1229-C), had high scores in an evaluation based on physicochemical parameters including hydrophilicity, polarity, accessibility and flexibility (Fig. 1b). Region-2 had no predicted B-cell epitope. Region-4 carried Epitope No. 4, but has an aa sequence identical to that of MUC1 in the mouse, indicating poor antigenicity in mouse. Thus, these two regions were not suitable candidates for an antigen. Epitope No. 5 had the highest score (1.00). In addition, homology evaluation using BLAST for isoforms of human MUC1 showed that the 19 aa sequence of Region-5 was identical in 45 isoforms, whereas the 19 aa sequence in Region-3 was identical in 35 isoforms [14]. Thus, the Region-5 containing Epitope No. 5 was selected as the antigen to raise MAb, and was named MUC1-common (RYVPPSSTDRSPYEKVSAG: N-1217-1235-C) because of its occurrence in most human MUC1 isoforms (Fig. 1b).
Anzeige
Immunization and screening for MUC1-positive hybridomas
The MUC1-common peptide with a cysteine attached to the N-terminus was synthesized by the Fmoc solid-phase method, followed by conjugation of maleimide-activated keyhole-limpet hemocyanin (KLH). C57BL/6 mice were immunized subcutaneously with 200 mg of the KLH-conjugated MUC1-common peptide emulsified in Freund’s complete adjuvant, and MAbs were produced according to the conventional method as described before [15].
As the result, five clones were isolated and continuously subcloned by the conventional limiting dilution method. After secondary screening by immunohistochemistry, a promising clone (clone 014E) was established, and the raised MAb was designated as MAb MUC1-014E.
Comparison with other anti-MUC1 antibodies
MAb MUC1-014E was compared immunohistochemically with the following anti-MUC1 antibodies (Fig. 2): MAb MUC1-Ab-5, raised against the C-terminal region of the MUC1 CTD [13] (Thermo Scientific, Fremont, CA, USA); polyclonal antibody (PAb) anti-MUC1*1110-ecd_P, which binds to the extracellular domain (45 aa: GTINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA: N-1110-1154-C) [12]; and PAb anti-MUC1*1110-ecd_R, which also binds to the extracellular domain (45 aa: GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA: N-1110-1154-C) (we note that the underlined amino acid at position N-1131 was P in Mahanta et al. [12], but R in the BLAST/NCBI nonredundant protein database [14]; thus, we made PAbs against both antigens by immunization of rabbits with synthetic peptides with KLH conjugated at the C-terminus); and MAb MUC1-DF3, which was raised against the TR region of MUC1 (TFB, Tokyo, Japan) [16‐18].
×
Comparison with anti-cytokeratin antibodies (AE1/AE3, CAM5.2)
MAb MUC1-014E was compared immunohistochemically with the MAbs against cytokeratin (CK), CK-AE1/AE3 (NCL-AE1/AE3; Leica Biosystems Newcastle, Newcastle, UK) or CK-CAM5.2 (Becton-Dickinson Immunocytometry Systems, San Jose, CA, USA).
Tissue samples
MAb MUC1-014E stained isolated cancer cells of scirrhous gastric cancers of por2 very well, in the preliminary immunohistochemical staining of the formalin-fixed paraffin-embedded tissue sections of human cancers of the stomach, colon, rectum, pancreas, biliary tract, lung, and ovary. Then, we examined gastrectomy specimens of 107 early gastric cancers (pT1b2). In the cases in which more than two histological types were mixed in one lesion, each histological pattern was evaluated independently, according to the JCGC [1].
Subsequently, we also examined 89 biopsy specimens with histological types of por2 and/or sig.
All specimens were obtained from the files of Kagoshima University Hospital and Kagoshima-shi Medical Association Hospital. The study was approved by the ethical committees of both hospitals.
Immunohistochemistry
Immunohistochemistry was performed by the immunoperoxidase method as follows. Antigen retrieval was performed using CC1 antigen retrieval buffer (Ventana Medical Systems, Tucson, AZ, USA) for all sections. Following incubation with the primary antibodies (MAb MUC1-014E diluted 1:5; PAb anti-MUC1*1110-ecd_P diluted 1:3,000; PAb anti-MUC1*1110-ecd_R diluted 1:1,500; MAb MUC1-DF3 diluted 1:10; MAb CK-AE1/AE3 diluted 1:500; MAb CK-CAM5.2 diluted 1:25) in phosphate-buffered saline (PBS) pH 7.4 with 1% bovine serum albumin, sections were stained on a Benchmark XT automated slide stainer using a diaminobenzidine detection kit (Ventana Medical Systems). MAb MUC1-Ab-5 (diluted 1:200 in PBS pH 7.4 with 1% bovine serum albumin), which was raised in hamster [13], was incubated with sections, followed by anti-hamster sheep serum diluted 1:4,000, and stained using an avidin-biotinylated horseradish peroxidase complex kit (Dako Japan, Tokyo, Japan) [19]. MAb MUC1-014E absorbed by MUC1-common (RYVPPSSTDRSPYEKVSAG: N-1217-1235-C) peptide showed negative staining. Reaction products were not present when non-immune serum or PBS was used instead of the primary antibodies. For simplicity, MUC1-014E, MUC1-Ab-5, MUC1*1110-ecd_P, MUC1*1110-ecd_R, MUC1-DF3, CK-AE1/AE3, and CK-CAM5.2 are used to indicate the antigens detected by each antibody.
Anzeige
Scoring of the results and statistical analysis
Three blinded investigators (S.Y., K.S., and M.G.) evaluated the immunohistochemical staining data independently. When the evaluation differed among the three, a final decision was made by consensus. The results were evaluated based on the percentage of positively stained carcinoma cells, using the following grading system: 0, <5% of carcinoma cells stained; 1+, ≥5 to <25%; 2+, ≥25 to <50%; 3+, ≥50 to <75%; and 4+, ≥75% stained. Cases with ≥5% of carcinoma cells stained were considered positive. The results for MUC1-014E were compared with those for other antigens using positive staining (total of 1+, 2+, 3+, and 4+) and 4+ staining (the highest intensity staining), as 4+ staining is required to avoid overlooking cancer cells in tissue examinations. Statistical analysis was performed by the Fisher exact test using SPSS 18 software.
Results
Immunohistochemical staining of MAb MUC1-014E and other anti-MUC1 antibodies in gastrectomy specimens
We examined gastrectomy specimens of 107 early gastric cancers (pT1b2) because we wished to avoid the major degenerative changes that are frequently seen in advanced cancer tissues. When more than two histological types were mixed in one lesion, each histological pattern was evaluated independently, according to the JCGC [1]. Therefore, in the 107 gastrectomy specimens, we could evaluate 200 carcinoma foci of various histological types in total (Fig. 2a–g).
Among the 200 lesions, there were 15 lesions of papillary adenocarcinoma (pap), 39 of well-differentiated tubular adenocarcinoma (tub1) (Fig. 3a), 52 of moderately differentiated tubular adenocarcinoma (tub2), 9 of solid type poorly differentiated adenocarcinoma (por1), 48 of por2 (Figs. 4a-lower, 5a, d), 31 of sig (Fig. 4a-upper), and 6 of mucinous adenocarcinoma (muc), based on the JCGC [1]. The por1, por2, and sig were classified into “poorly cohesive carcinoma (including signet-ring cell carcinoma and other variants)” in the World Health Organization (WHO) classification of tumours of the stomach [20]. The results of immunohistochemical staining of the lesions with each antibody were as follows.
×
×
×
MAb MUC1-014E
MAb MUC1-014E showed positive staining of carcinoma cells at very high rates (97–100%) for most histological types, i.e., pap, tub1, tub2, por2, sig, and muc (Fig. 2a–c, e–g: upper bars), with the exception of por1 (44%) (Fig. 2d: upper bar). MAb MUC1-014E showed 4+ staining for all 48 por2 lesions (100%) (Fig. 2e: lower bar) and 4+ staining for high percentages (80–90%) of most other histological types (Fig. 2a–c, f, g: lower bar), again with the exception of por1 (33%) (Fig. 2d: lower bar). MUC1-014E was present mainly at cell apexes in pap, tub1 (Fig. 3b), and tub2, and mainly at apexes of floating carcinoma cells in mucin in muc. In contrast, MUC1-014E was present in the cytoplasm of por1 and por2 (Figs. 4b-lower, 5b, e) and in intracellular pooled mucin of sig (Fig. 4b-upper). MAb MUC1-014E detected isolated carcinoma cells sharply and specifically, even for por2 carcinoma cells scattered in fibrous tissue (Fig. 5b, e), and clearly showed the deepest margin of invasion (Fig. 5e).
MAb MUC1-Ab-5
MAb MUC1-Ab-5 also showed positive staining of carcinoma cells at very high rates (84–100%) for most histological types (Fig. 2a–c, e–g: upper bars), with the exception of por1 (44%) (Fig. 2d: upper bar), with no significant differences in positive staining rates compared with MAb MUC1-014E (Fig. 2a–g: upper bars). However, the 4+ staining rates with MAb MUC1-Ab-5 were significantly lower than those with MAb MUC1-014E for tub2, por2, and sig (Fig. 2c, e, f: lower bars), but not significantly lower for other histological types (Fig. 2a, b, d, g: lower bars). The staining patterns of MAb MUC1-Ab-5 were similar to those of MAb MUC1-014E. MUC1-Ab-5 was expressed weakly mainly at cell apexes in pap, tub1 (Fig. 3c), and tub2; mainly at apexes of floating carcinoma cells in mucin in muc; in the cytoplasm in por1 and por2 (Figs. 4c-lower, 5c, f); and in intracellular pooled mucin in sig (Fig. 4c-upper). MAb MUC1-Ab-5 also stained por2 carcinoma cells scattered in fibrous tissue (Fig. 5c, f), but this staining was neither clear nor sharp compared with MAb MUC1-014E staining (Fig. 5b, e). In addition, MAb MUC1-Ab-5 also showed nonspecific immunostaining of inflammatory cells (Fig. 4c).
PAb anti-MUC1*1110-ecd_P
PAb anti-MUC1*1110-ecd_P showed positive staining of carcinoma cells at significantly lower rates than MAb MUC1-014E for por2 and sig (Fig. 2e, f: upper bars), but not for other histological types (Fig. 2a–d, g: upper bars). It also showed significantly lower rates of 4+ staining for tub1, tub2, por2, and sig (Fig. 2b, c, e, f: lower bars), but not in others (Fig. 2a, d, g: lower bars). The staining patterns for PAb anti-MUC1*1110-ecd_P were similar to those for MAb MUC1-014E, but weak compared with those for MAb MUC1-014E, mainly at cell apexes in pap, tub1 (Fig. 3d), and tub2; mainly at apexes of floating carcinoma cells in mucin in muc; and in the cytoplasm in por1 and por2 (Fig. 4d-lower); and a very weak presence in intracellular pooled mucin in sig (Fig. 4d-upper). PAb anti-MUC1*1110-ecd_P also stained por2 carcinoma cells scattered in the fibrous tissue, but much less clearly and sharply compared with MAb MUC1-014E. Nonspecific immunostaining of inflammatory cells was also seen with PAb anti-MUC1*1110-ecd_P (Fig. 4d).
PAb anti-MUC1*1110-ecd_R
PAb anti-MUC1*1110-ecd_R showed positive staining of carcinoma cells at significantly lower rates than MAb MUC1-014E in many histological types (tub1, tub2, por2, sig, and muc) (Fig. 2b, c, e–g: upper bars), but not in others (Fig. 2a, d: upper bars). It also showed significantly lower rates of 4+ staining in most histological types (Fig. 2a–c, e–g: lower bars), except for por1 (Fig. 2d: lower bar). PAb anti-MUC1*1110-ecd_R showed no or very weak staining of por2 and sig (Fig. 4e) compared with PAb anti-MUC1*1110-ecd_P (Fig. 4d), despite a difference of only one amino acid (P vs. R at position N-1131 in MUC1) in these antigens.
MAb MUC1-DF3
MAb MUC1-DF3 showed positive staining of carcinoma cells at significantly lower rates than MAb MUC1-014E in many histological types (tub1, tub2, por2, sig, and muc) (Fig. 2b, c, e–g: upper bars), but not in pap and por1 (Fig. 2a, d: upper bars). It also showed significantly lower rates of 4+ staining in most histological types (Fig. 2a–c, e–g: lower bars), except for por1 (Fig. 2d: lower bar). Although several cases of pap and/or tub1 showed intense and clear staining by MAb MUC1-DF3 at the apexes of carcinoma cells (Fig. 3f), most cases of por2 and/or sig showed no staining by MAb MUC1-DF3 (Fig. 4f). MAb MUC1-DF3 did not show nonspecific immunostaining of inflammatory cells (Fig. 4f), in contrast to that seen in staining with MAb MUC1-Ab-5 (Fig. 4c) and PAb anti-MUC1*1110-ecd_P (Fig. 4d).
Summary of immunohistochemical staining in gastrectomy specimens
Overall, in the gastrectomy specimens, MAb MUC1-014E showed the highest rates of positive and 4+ staining in most histological types. Particularly in 4+ staining of por2 (Fig. 2e: lower bar) and sig (Fig. 2f: lower bar), MUC1-014E had significantly higher rates than those for other MUC1 antigens. These tendencies were also seen for tub2 (Fig. 2c), followed by tub1 (Fig. 2b), muc (Fig. 2g), and pap (Fig. 2a).
Anzeige
MAb MUC1-014E showed intense, sharp, and specific staining of carcinoma cells, but never stained stromal cells such as fibroblasts, endothelial cells, and inflammatory cells (Figs. 3b, 4b, 5b, e) compared with the other MUC1-related antibodies (Figs. 3c–e, 4c–f, 5c, f).
Immunohistochemical staining in normal gastric mucosa
In the normal gastric mucosa, MUC1-014E, MUC1-Ab-5, MUC1*1110-ecd_P, and MUC1*1110-ecd_R were always present in the surface mucous epithelium and in the fundic and pyloric glands. MUC1-DF3 was present in the surface mucous epithelium in several cases, and always in the fundic glands, but not in the pyloric glands. CK-AE1/AE3 and CK-CAM5.2 were expressed in the surface mucous epithelium. However, there is no problem because of the simple morphological recognition of the normal gastric mucosa.
Immunohistochemical staining of MAb MUC1-014E and other anti-MUC1 antibodies in biopsy specimens, in comparison with cytokeratin
In the gastrectomy specimens, MUC1-014E showed significantly higher rates than those for other MUC1 antigens, particularly in the 4+ staining of por2 (Fig. 2e: lower bar) and sig (Fig. 2f: lower bar). Thus, we examined 89 biopsy specimens with histological types of por2 and/or sig to examine the utility of MAb MUC1-014E for pathological diagnosis of por2 and sig in biopsy specimens, because these types are frequently seen in scirrhous gastric cancers with a very poor prognosis [2]. In the 89 biopsy specimens, we could evaluate 82 por2 lesions and 38 sig lesions (Fig. 6a, b).
×
For por2, the MAb MUC1-014E positive rate (100%) and 4+ rate (87%) were significantly higher than the other MUC1-related antibodies (Fig. 6a: upper and lower bars). For sig, the MAb MUC1-014E positive rate (100%) did not differ significantly from that for MUC1-Ab-5, but was significantly higher than those for MUC1*1110-ecd_P, MUC1*1110-ecd_R and MUC1-DF3 (Fig. 6b: upper bar), whereas the MAb MUC1-014E 4+ rate (84%) was significantly higher than the other MUC1-related antibodies (Fig. 6b: lower bar).
Anzeige
In the comparison of the MAb MUC1-014E staining with CK stainings in por2 and sig, the MUC1-014E positive rates (100% in por2 and 100% in sig) and 4+ rates (87% in por2 and 84% in sig) were significantly higher than the CK-AE1/AE3 positive rates (72% in por2 and 68% in sig) and 4+ rates (15% in por2 and 16% in sig), or than the CK-CAM5.2-positive rates (88% in por2 and 82% in sig) and 4+ rates (34% in por2 and 34% in sig) (Fig. 6a, b).
MAb MUC1-014E detected carcinoma cells of por2 (Fig. 7a) and sig sharply and specifically (Fig. 7b), compared with the other MUC1-related antibodies (Fig. 7c–f), without showing the nonspecific staining of inflammatory cells seen with MAb MUC1-Ab-5 (Fig. 7c) and PAb anti-MUC1*1110-ecd_P (Fig. 7d). The immunostaining of MAb MUC1-014E for por2 (Fig. 7b) and sig was much clearer than that of CK-AE1/AE3 (Fig. 7g) or CK-CAM5.2 (Fig. 7h).
×
Discussion
In the present study, we raised a novel antibody, MAb MUC1-014E, that showed high rates of detection of carcinoma cells in several types of gastric cancer. In particular, MAb MUC1-014E clearly and sharply detected carcinoma cells in por2 and sig lesions, which are frequently seen in scirrhous gastric cancers and are associated with a very poor prognosis [2], in both gastrectomy and biopsy specimens. The por2 and sig cells tend to be scattered in granulation tissue or desmoplastic fibrotic tissue, and are often difficult to detect with routine H&E staining. Among all tested antibodies, MAb MUC1-014E showed 4+ and clear staining for por2 and sig, indicating that the new antibody will be very useful for detection of por2 or sig. MAb MUC1-014E staining was also highly positive in other histological types of gastric cancer, except for por1. Nevertheless, the por1 is easy to identify based on its solid pattern in routine H&E staining.
MAb MUC1-Ab-5 and PAb anti-MUC1*1110-ecd_P also stained carcinoma cells in por2 and sig lesions at relatively high rates, but at rates lower than with MAb MUC1-014E. The sharpness and specificity of immunohistochemical staining using MAb MUC1-014E, which stained cancer cells but not inflammatory cells, was also much better than with MAb MUC1-Ab-5 or PAb anti-MUC1*1110-ecd_P, which reacted with not only cancer cells but also inflammatory cells.
PAb anti-MUC1*1110-ecd_R and MAb MUC1-DF3 showed no or low staining in por2 and sig lesions. The positive rates were higher for MUC1*1110-ecd_P than for MUC1*1110-ecd_R in all histological types of gastric cancer, even though there is a difference of only one amino acid at position N-1131 of MUC1 (P vs. R) between the two antigens. It is unclear how this relatively small difference gives rise to such a large difference in antigenicity. Staining with MAb MUC1-DF3 was significantly lower than with MUC1-014E in most histological types, except for pap and por1. MAb MUC1-DF3 is an anti-MUC1 antibody against the TR region of the extracellular domain [16‐18], and the low MUC1-DF3 expression may be related to loss of this domain caused by cleavage [3, 9]. In contrast, MUC1-014E (N-1217-1235-C) and MUC1-Ab-5 (N-1239-1255-C) are located side by side in the MUC1 CTD. Because both antigens may be present in carcinoma cells even after the cleavage of the MUC1 molecule, they may have high levels in many types of gastric cancers.
The CK-AE1/AE3 or CK-CAM5.2 immunostaining was used to be effective to detect the carcinoma cells in por2 or sig [21]. The present study in the biopsy specimens demonstrated that the MUC1-014E-positive rate and 4+ rate were significantly higher than those for CK-AE1/AE3 or CK-CAM5.2, and the MAb MUC1-014E staining was generally clearer than the CK-AE1/AE3 or CK-CAM5.2 staining. For accurate detection of the carcinoma cells in por2 or sig, MAb MUC1-014E is useful as well as CK-AE1/AE3 or CK-CAM5.2.
Our immunohistochemical results are also of interest in the context of common histological classification of gastric cancer in JCGC [1], in which poorly differentiated adenocarcinoma is classified into por1 (solid type) and por2 (non-solid type), as well as in the context of WHO classification of tumours of the stomach, in which por1 and por2 were classified into “poorly cohesive carcinoma (including signet-ring cell carcinoma and other variants)” [20]. There is a marked difference in expression of MUC1 between por1 and por2 lesions, with the MUC1 expression pattern in por2 being very similar to that of sig, and also similar to that of tub2. Coexistence of por2 and sig is frequently observed, as shown in Fig. 4, and coexistence of tub2 and por2 and/or sig is also common. A relatively high frequency of por1 lesions are found in elderly patients and in cases with specific microsatellite instability, expansive growth, and lymphocytic infiltration [22]. In contrast, por2 tends to affect younger patients and frequently has hereditary characteristics [23, 24]. The marked difference in MUC1 expression between por1 and por2 may also be an area for future study.
In conclusion, the novel MAb MUC1-014E is very useful for accurate identification of por2 or sig carcinoma cells that are frequently seen in scirrhous gastric cancer.
Acknowledgments
We thank Mr. Y. Atsuchi, Ms. C. Baba, Ms. Y. Nishimura, Ms. S. Yoshimura, and Ms. I. Houjou for their technical assistance. This study was supported in part by Grants-in-Aid for Scientific Research on Priority Areas 20014022, Scientific Research (C) 20590345, and Scientific Research (B) 23390085 to S. Yonezawa; Scientific Research (C) 21590399 to M. Higashi; Scientific Research on Priority Areas 219447 to N. Yamada (JSPS Fellowship) and 239349 to S. Kitamoto (JSPS Fellowship) from the Ministry of Education, Science, Sports, Culture and Technology, Japan; by an International Educational Research Support Project for Islands, Environment and Medicine, Kagoshima University, Japan to S. Yokoyama; and by the Kodama Memorial Foundation, Japan to M. Higashi and S. Yokoyama.
Conflict of interest
The authors declare that they have no conflict of interest regarding the work in the study.
Open Access
This article is distributed under the terms of the Creative Commons Attribution Noncommercial License which permits any noncommercial use, distribution, and reproduction in any medium, provided the original author(s) and source are credited.
Open AccessThis is an open access article distributed under the terms of the Creative Commons Attribution Noncommercial License (https://creativecommons.org/licenses/by-nc/2.0), which permits any noncommercial use, distribution, and reproduction in any medium, provided the original author(s) and source are credited.
Mit e.Med Innere Medizin erhalten Sie Zugang zu CME-Fortbildungen des Fachgebietes Innere Medizin, den Premium-Inhalten der internistischen Fachzeitschriften, inklusive einer gedruckten internistischen Zeitschrift Ihrer Wahl.
A novel anti-MUC1 antibody against the MUC1 cytoplasmic tail domain: use in sensitive identification of poorly differentiated cells in adenocarcinoma of the stomach
Nach PCI besteht ein erhöhtes Blutungsrisiko, wenn die Behandelten eine verminderte linksventrikuläre Ejektionsfraktion aufweisen. Das Risiko ist umso höher, je stärker die Pumpfunktion eingeschränkt ist.
In einer Leseranfrage in der Zeitschrift Journal of the American Academy of Dermatology möchte ein anonymer Dermatologe bzw. eine anonyme Dermatologin wissen, ob er oder sie einen Patienten behandeln muss, der eine rassistische Tätowierung trägt.
Der Einsatz von Wundprotektoren bei offenen Eingriffen am unteren Gastrointestinaltrakt schützt vor Infektionen im Op.-Gebiet – und dient darüber hinaus der besseren Sicht. Das bestätigt mit großer Robustheit eine randomisierte Studie im Fachblatt JAMA Surgery.
Der belastende Arbeitsalltag wirkt sich negativ auf die psychische Gesundheit der Angehörigen ärztlicher Berufsgruppen aus. Chirurginnen und Chirurgen bilden da keine Ausnahme, im Gegenteil.
Update Chirurgie
Bestellen Sie unseren Fach-Newsletterund bleiben Sie gut informiert.
Das Karpaltunnelsyndrom ist die häufigste Kompressionsneuropathie peripherer Nerven. Obwohl die Anamnese mit dem nächtlichen Einschlafen der Hand (Brachialgia parästhetica nocturna) sehr typisch ist, ist eine klinisch-neurologische Untersuchung und Elektroneurografie in manchen Fällen auch eine Neurosonografie erforderlich. Im Anfangsstadium sind konservative Maßnahmen (Handgelenksschiene, Ergotherapie) empfehlenswert. Bei nicht Ansprechen der konservativen Therapie oder Auftreten von neurologischen Ausfällen ist eine Dekompression des N. medianus am Karpaltunnel indiziert.
Das Webinar beschäftigt sich mit Fragen und Antworten zu Diagnostik und Klassifikation sowie Möglichkeiten des Ausschlusses von Zusatzverletzungen. Die Referenten erläutern, welche Frakturen konservativ behandelt werden können und wie. Das Webinar beantwortet die Frage nach aktuellen operativen Therapiekonzepten: Welcher Zugang, welches Osteosynthesematerial? Auf was muss bei der Nachbehandlung der distalen Radiusfraktur geachtet werden?
Inhalte des Webinars zur S1-Leitlinie „Empfehlungen zur Therapie der akuten Appendizitis bei Erwachsenen“ sind die Darstellung des Projektes und des Erstellungswegs zur S1-Leitlinie, die Erläuterung der klinischen Relevanz der Klassifikation EAES 2015, die wissenschaftliche Begründung der wichtigsten Empfehlungen und die Darstellung stadiengerechter Therapieoptionen.